7ZQJA

Mhc class i from a wild bird in complex with a nonameric peptide p3
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
274
structure length
274
Chain Sequence
MVLHSLHYLDVAVSEPSPGIPQFVAMGFVDGIPFTRYDSERGRMEPLTEWIKDSADPEYWDSQTQIGVGSQHVYARSLETLRERYNQSGGLHTVLRVYGCELLSDGSVRGSERFGYDGRDFISFDLESGRFMAADSAAEITRRRWEHEGIVAERQTNYLKHECPEWLQKYVGYGQKELERKEPPDVHVSGKEEHGTLILSCHAYGFYPKTIAVNWMKGDEIWDQETEWGGVVPNSDGTFHTWARIEALPEEREQYRCRVEHPGMPEPGIFAWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extraordinary peptide-binding mode of a songbird MHC class-I molecule suggests mechanism to counter pathogen immune evasion
rcsb
molecule tags Immune system
source organism Acrocephalus arundinaceus
molecule keywords MHC class I antigen
total genus 69
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2022-04-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...