7ZXFD

Pfs48/45 bound to monoclonal antibodies 10d8 and 85rf45.1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
214
Chain Sequence
EVMLVESGGDLVKPGGSLKVSCAASGFTFSNYAMSWVRQTPEKRLEWVATISSGASYTHYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCGRQVNRHDRALDAMDYWGQGTSVTVSPAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Gametocyte surface protein P45/48
publication title Structure of the malaria vaccine candidate Pfs48/45 and its recognition by transmission blocking antibodies.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 38
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2022-05-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...