8D4WA

Asymmetric ene-reduction of alpha,beta-unsaturated compounds using msmeg_2850
Total Genus 38

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
IDWDQMNNQVIKEFRETGGKAGGLFEGSPLVLVHHTGAKSGKQRIAPLVPLLDGDRIYIFGSKGGADSHPDWYHNLVANPDTVVELGTETFPVKARVLTGAERDEIYAKQVAVAPQFGDYQRKTTRVIPVVELQRV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-21)TIV1 (42-45)TI'1 (21-24)S5 (85-90)3H1 (27-29)EMPTYS2 (47-52)TI1 (29-32)TIV2 (56-59)S3 (55-57)S7 (134-139)AH2 (75-82)TII'2 (90-93)S6 (93-102)AH4 (119-127)S4 (60-64)3H2 (67-69)AH3 (104-117)S1 (35-40)TI2 (41-44)Updating...
connected with : NaN
molecule tags Oxidoreductase
source organism Mycolicibacterium smegmatis
publication title Asymmetric Ene-Reduction of alpha , beta-Unsaturated Compounds by F 420 -Dependent Oxidoreductases A Enzymes from Mycobacterium smegmatis .
pubmed doi rcsb
molecule keywords Cell entry (Mce) related family protein
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 1.-.-.-:
pdb deposition date 2022-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.