8I19A

Crystal structure of human mth1(g2k mutant) in complex with 8-oxo-dgtp at ph 8.0
Total Genus 43

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS5 (65-74)TII4 (74-77)TI1 (14-17)TI3 (107-110)S2 (17-23)TII1 (26-29)TII2 (28-31)S3 (31-33)TIV2 (139-142)3H1 (113-115)TII3 (40-43)AH1 (45-57)TI2 (98-101)S8 (132-140)S6 (80-88)S7 (101-107)TIV1 (108-111)O1 (111-113)S1 (4-14)S4 (35-38)AH2 (119-129)S9 (144-153)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Homo sapiens
publication title Protonation states of Asp residues in the human Nudix hydrolase MTH1 contribute to its broad substrate recognition.
pubmed doi rcsb
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
total genus 43
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.56: 2-hydroxy-dATP diphosphatase.
pdb deposition date 2023-01-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.