8A7VA

Room temperature rsegfp2 in its off-state obtained with sfx
Total Genus 66

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
234
Chain Sequence
HHHTDPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGIT

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (0-8)EMPTYTIV2 (89-92)S1 (13-23)S3 (42-49)S2 (26-37)TIV1 (22-25)TI2 (132-135)3H1 (38-40)TI1 (49-52)S11 (218-228)TI6 (211-214)3H3 (70-72)S6 (119-129)3H4 (77-82)S10 (200-209)AH2 (84-88)TVIa1 (88-91)S4 (93-101)TIV3 (115-118)S9 (177-188)TII1 (101-104)S5 (106-116)TIV4 (135-138)TI3 (136-139)TI4 (137-140)TI5 (172-175)S7 (149-156)S8 (161-171)3H2 (58-64)3H5 (157-159)Updating...
connected with : NaN
molecule tags Fluorescent protein
source organism Aequorea victoria
publication title Serial Femtosecond Crystallography Reveals that Photoactivation in a Fluorescent Protein Proceeds via the Hula Twist Mechanism.
pubmed doi rcsb
molecule keywords Green fluorescent protein
total genus 66
structure length 234
sequence length 235
ec nomenclature
pdb deposition date 2022-06-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.