8A9SA

Crystal structure of ca2+-discharged obelin in complex with coelenteramine-v
Total Genus 69
20406080100120140160180010203040506070
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
192
Chain Sequence
KYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
2040608010012014016018015010050
0102030405060Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (12-15)AH8 (168-180)3H1 (184-186)AH1 (16-29)TII'1 (190-193)TI2 (30-33)TII1 (78-81)AH3 (58-74)AH5 (110-122)AH4 (85-105)TII2 (186-189)AH7 (148-157)TI4 (161-164)TI5 (188-191)S1 (36-38)AH2 (39-54)TI3 (123-126)AH6 (132-142)S2 (82-84)TIV1 (143-146)Updating...
connected with : NaN
molecule tags Luminescent protein
source organism Obelia longissima
publication title Crystal structure of semi-synthetic obelin-v after calcium induced bioluminescence implies coelenteramine as the main reaction product.
pubmed doi rcsb
molecule keywords Obelin
total genus 69
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2022-06-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.