8AB2A

Crystal structure of the lactate dehydrogenase of cyanobacterium aponinum in its apo form.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
329
Chain Sequence
MFEKILLSNPSAENPSSLRPRKGIIIGLGQVGLACAYSMLIQDCFDELVLQDIASDKLEGEVMDFSHGMPFIPPTDIKAGTIANEGRNADIVIITAGVAQKEGESRLSLLERNIAIYKKILADVVKYCPEAIILVVTNPVDIMTYATLKITGFPSSRIIGSGTVLDTARFRTLLAKEMDIDPRSVHAYIIGEHGDSEVPVWSTANVGGMKLVPNTWADLPEDEKATLSGIFQKVQNAAYDIIKLKGYTSYAIGLATTDIVKAILNSQERILTVSGLMTGMYGIEDVCLSIPRVVSERGIIKTVNLTLSEDEEKLLQQSAKMLKEVFDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Crystal Structure of the Lactate Dehydrogenase of Cyanobacterium Aponinum in its apo form.
rcsb
source organism Cyanobacterium aponinum
total genus 112
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2022-07-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...