8AB9E

Complex iii2 from yarrowia lipolytica, ascorbate-reduced, b-position
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
GKSTYKIPDFTPYLKKDRNTDANRLFSYFMIGSFGMLSAAGAKATVQDFLSNMSASADVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the conformational heterogeneity of the Rieske iron-sulfur protein in complex III 2 by cryo-EM.
pubmed doi rcsb
molecule keywords Cytochrome b
molecule tags Membrane protein
total genus 20
structure length 61
sequence length 61
chains with identical sequence P
ec nomenclature ec 7.1.1.8: quinol--cytochrome-c reductase.
pdb deposition date 2022-07-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...