8ACXA

Pathogen effector of zymoseptoria tritici: zt-kp4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
112
Chain Sequence
NNCDGSTFVPVTGSAGNAPSKWDCQLLRDGYIAKQNKSWLISGPRIIGTVRTCQFSATVDVSGTAGWIGRDDIMDLMKDSLNLWAMQVGESGDVNCVAGGQKVRIAWTLGHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Hce2 domain-containing protein
publication title Structure of ZT-PK4:a pathogen effector protein of Zymoseptoria tritici at 1.9 A
rcsb
source organism Zymoseptoria tritici
total genus 29
structure length 112
sequence length 126
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2022-07-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...