8AG9A

Thermogutta terrifontis endoglucanase of glycoside hydrolase family 5 (ttend5a)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
335
structure length
335
Chain Sequence
EVFKGHNLPRLRGAMIGPHVTNADLLEFGNVWKANHIRWQLIWNGFPHSPADSATLDEYRQWLDGALKRLEAALPVCREAGILVTVDLHTPPGGRNEASECRIFHDREFQKAFIDIWEDIARRFADSDVVWGYDLVNEPVEGMVPDGLMNWQRLAEETARRVRAIDQKHAIIIEPAPWGSPSSIALLDPIDVPGVVYSVHMYVPHAFTHQGVYDNPVGIVYPGTIDGKWYDRNTLRKVLEPVRRFQEENGVHIYIGEFSAIRWAPADSACQYLKDCIEIFEEYGWDWAYHAFREWDGWSVEHGPDRNDRNRTATPTDRALLLRSWYAENVKPQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermogutta terrifontis endoglucanase of glycoside hydrolase family 5 (TtEnd5A)
rcsb
molecule tags Hydrolase
source organism Thermogutta terrifontis
molecule keywords Endoglucanase
total genus 128
structure length 335
sequence length 335
ec nomenclature ec 3.2.1.4: cellulase.
pdb deposition date 2022-07-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...