8AMSA

Complex of human trim2 ring domain, ubch5c, and ubiquitin
Total Genus 39
204060801001201400510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
GHMALKRINKELSDLARDPPAQCRAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSISLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (1-15)TVIa1 (59-62)TI1 (18-21)S1 (21-25)TI3 (40-43)S2 (32-39)TI5 (57-60)S3 (48-55)TI4 (43-46)EMPTYTII1 (45-48)TI6 (75-78)AH4 (131-146)S4 (66-69)TVIII2 (61-64)TI9 (94-97)TIV2 (60-63)AH2 (99-111)3H1 (87-89)TI7 (79-82)TI10 (114-117)TVIII3 (118-121)TIV5 (128-131)TIV1 (25-28)TI2 (29-32)AH3 (121-128)TIV3 (89-92)Updating...
connected with : NaN
molecule tags Antiviral protein
source organism Homo sapiens
publication title Structural and biophysical studies of TRIM2 and TRIM3
rcsb
molecule keywords Ubiquitin-conjugating enzyme E2 D3
total genus 39
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2022-08-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.