8ANDAAA

Domain swapped dimer of smolstatin (stefin) from sphaerospora molnari
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
GGFSEWKDPDAYTTKIVKAMESKLFEKLSLPNQPEVSFLRYREQIVSGVNYCMRVKIGSDFYDLHIYVPLGSTGDIKSHLIQLTDLHLASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Domain swapped dimer of smolstatin (stefin) from Sphaerospora molnari
rcsb
molecule keywords Smolstatin
molecule tags Hydrolase inhibitor
source organism Sphaerospora molnari
total genus 13
structure length 91
sequence length 91
chains with identical sequence BBB
ec nomenclature
pdb deposition date 2022-08-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...