8ARLA

Plasmodium vivax pvp01_0000100 trag domain
Total Genus 110

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
232
structure length
232
Chain Sequence
DKSDEWKKNEWNNWLIKTEEDWKLFNTAVENKKNRWLEKRDKELEVWLMNMQNRWLHYRENEENEYKAEAMKNSATWDDSQWEQWIKTEGKKGMEADLKKWLNDKETFLDGWISKEWVQWKNERMLQWLSVDWKHKEDETFEHYKSSKFTNVLHIKKKKKWTKWKERTNKEKEEWNNWVKGKENLYVNNKWDKWLKWKKDKRALYSQKFLTFINKWISDKQWTVWIEDQGGS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell invasion
source organism Plasmodium vivax
publication title The crystal structure of a Plasmodium vivax Tryptophan Rich Antigen (TRAg) reveals lipid binding properties and suggests a molecular function for this large Plasmodium-specific multi-gene family
rcsb
molecule keywords Tryptophan-rich antigen
total genus 110
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2022-08-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.