8AY8B

X-ray crystal structure of the cspyl1(v112l, t135l,f137i, t153i, v168a)-isb9-hab1 ternary complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
320
structure length
298
Chain Sequence
CIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELGRQVQWDKVFTSCFLTVDGEIEGKIGRADKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided engineering of a receptor-agonist pair for inducible activation of the ABA adaptive response to drought.
pubmed doi rcsb
molecule tags Plant protein
source organism Citrus sinensis
molecule keywords Abscisic acid receptor PYR1
total genus 95
structure length 298
sequence length 320
ec nomenclature ec 3.1.3.16: protein-serine/threonine phosphatase.
pdb deposition date 2022-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...