8B2MA

Matrix-metallopeptidase inhibitor potempin a (pota) from tannerella forsythia
Total Genus 17

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
KDQSSCCDKEIIKDVSELTGIISYNTEVKRWYISVSDANSYDNVTLYFPCNLDSKYMKEKEKVIFSGQISKSTLKITLPAGTTSYCINLMSINKIN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (33-47)3H1 (76-78)TII1 (80-83)S4 (83-92)TI1 (48-51)S2 (52-58)TI2 (59-62)TIV2 (71-74)O1 (78-80)TI3 (62-65)TIV1 (47-50)S3 (66-71)Updating...
connected with : NaN
molecule tags Hydrolase inhibitor
source organism Tannerella forsythia
publication title A unique network of attack, defence and competence on the outer membrane of the periodontitis pathogen Tannerella forsythia.
pubmed doi rcsb
molecule keywords Tannerella forsythia Potempin A (PotA)
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2022-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.