8B2NB

Potempin a (pota) from tannerella forsythia in complex with the catalytic domain of human mmp-12
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
SCCDKEIIKDVSELTGIISYNTEVKRWYISVSDANSYDNVTLYFPCNLDSKYMKEKEKVIFSGQISKSTLKITLPAGTTSYCINLMSINKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique network of attack, defence and competence on the outer membrane of the periodontitis pathogen Tannerella forsythia.
pubmed doi rcsb
molecule keywords Macrophage metalloelastase
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2022-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...