8B3SA

Structure of yjba in complex with clpc n-terminal domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
240
Chain Sequence
HMMLFLHDVWVNWFEGEENGYNVCHFHEWRKEDTVELLDQVPLLRVPSVLFHYIENDLSELPKGLLEDVHQKSYIRKNHERTKLEYCFVVTDGIGILAVDTIGYTIPVRKSRLIPRQEQLVYEMVKDVEPETYEFEPEYHILSLAPEHVRGLTRKERQIKQLMFMALDQLKGLKNRAEIGYWYTEWNPHMYEQIKRMSFEEIWDMLYNETIEGWSDKHLAFCENLIKGQPFFEKLWEMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords UPF0736 protein B4122_0676,UPF0736 protein YjbA
publication title Structure of YjbA in complex with ClpC N-terminal Domain
rcsb
source organism Bacillus subtilis
total genus 80
structure length 240
sequence length 247
ec nomenclature
pdb deposition date 2022-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...