8B58A

Crystal structure of cyclophilin tgcyp23 from toxoplasma gondii in complex with cyclosporin a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
199
structure length
199
Chain Sequence
SLLSESELPAGISYAEAMEGGSRPLLHPDNPVVFFDISIGSHEAGRIKIELFKNLAPKSAENFRQFCTGEFRQNQVPIGYKGATFHRIIKNFMIQGGDFVKGDGTGRLSIYGSSFPDEAFVLPHFRSGLLSLANSGPDTNGCQFFITCAKCDWLNRKHVVFGQVLGKESMQVVRKIEHVTVDGGNRPRIPVTVTQCGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cyclosporin Isoform-Specific Inhibition of Cyclophilins from Toxoplasma gondii .
pubmed doi rcsb
molecule tags Isomerase
source organism Toxoplasma gondii
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 62
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2022-09-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...