8B7WC

Complex il-17a/anti-il-17a-76
Total Genus 10

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
105
Chain Sequence
RTVMVNLNIHNPKRSSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHH

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (51-57)S4 (76-78)TIV4 (73-76)AH1 (37-46)TIV2 (58-61)TIV3 (61-64)S6 (88-101)TI2 (84-87)S5 (82-84)TI1 (78-81)S2 (61-62)TIV1 (47-50)S3 (65-71)Updating...
connected with : NaN
molecule tags Immune system/inhibitor
source organism Lama glama
publication title Two Epitope Regions Revealed in the Complex of IL-17A and Anti-IL-17A V H H Domain.
pubmed doi rcsb
molecule keywords anti-IL-17A-76
total genus 10
structure length 105
sequence length 111
ec nomenclature
pdb deposition date 2022-10-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.