8B8RA

Complex of echovirus 11 with its attaching receptor decay-accelerating factor (cd55)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
287
structure length
287
Chain Sequence
GDVVEAIEGAVARVADTISSGPTNSQAVPALTAVETGHTSQVVPGDTMQTRHVKNYHSRSESTIENFLSRSACVYMGEYYTTNTDETKRFASWTINARRMVQMRRKLEMFTYVRFDVEVTFVITSKQDQGTQLGQDMPPLTHQIMYIPPGGPIPKSTTDYAWQTSTNPSIFWTEGNAPPRMSIPFVSIGNAYSNFYDGWSHFSQNGVYGYNTLNNMGQLYMRHVNGPSPLPMTSIVRVYFKPKHVKAWVPRPPRLCQYKNASTVNFSSTNITDKRDSITHVPDTVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching of Receptor Binding Poses between Closely Related Enteroviruses.
pubmed doi rcsb
molecule tags Virus
source organism Homo sapiens
molecule keywords VP1
total genus 48
structure length 287
sequence length 287
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2022-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...