8B9NA

Crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
285
structure length
239
Chain Sequence
MVEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSVYSGVETLGKELFMYFGHRALRIHFGMKGSILINPRSPALAVQLTRDLICFYDSSVELRNSVESQQRVREMEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQARHLVKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCGQCHSKITVCRFGENSRMTYFCPHCQKDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NEI domain of mouse NEIL3 trapped in covalent complex with ssDNA with abasic site
rcsb
molecule keywords Endonuclease 8-like 3
molecule tags Dna binding protein
source organism Mus musculus
total genus 85
structure length 239
sequence length 285
chains with identical sequence C
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2022-10-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...