8BALA

Niako3494, a bacterial protein structure in glycoside hydrolase family 20
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
349
structure length
345
Chain Sequence
QFEWNKLPVKAMLLTVPHPEDVPEFCRFIKEVLPKEGVNTLVLRIRYNYKFKSHPELAGERAISEQQLKQIVQTCKEAKIRFIPKMNLLGHQSDRDHIDPLLAKYPQFDESPDYNPPVPWKFDFYCKSLCPSHPDLLKTIFPLMDELIDVCGADAFHVGLDEVWILGYEKCPRCGGRDKAALFAEYATKLHDHLKEKKCQMWMWSDRLIDGKTTNLLGWQASMNATFRAIDLIPTDIMICDWKYESAPPTPGYFAIKGFNVLPSSCSNSEVALAQLAQVRLARKDGTRAPWAVTLAERMQGVFVTMWEDSKEFIDAYYGRNGKKLPSAETFKAVFAQIRKEEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and Structural Insights into the Specificity and Biological Functions of Bacterial Sulfoglycosidases
doi rcsb
molecule tags Hydrolase
source organism Niastella koreensis gr20-10
molecule keywords Beta-N-acetylhexosaminidase
total genus 102
structure length 345
sequence length 349
chains with identical sequence C, D, E, F
ec nomenclature ec 3.2.1.52: beta-N-acetylhexosaminidase.
pdb deposition date 2022-10-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...