8BBLA

Sgl a gh20 family sulfoglycosidase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
548
structure length
515
Chain Sequence
ADETRSFWITCQAGGTKYLNTNTSNNATVQYAGGNGNWSTFYIYKVIIPAPRGAELNGEGRLALSAMDNISFTTDPALAEEAYVLNITADGISVASSTEKGKFYALQSLAQLAEGNAEGLPLVRIADKPRFGYRGFMLDVSRHFFSVAEVKKMIDIMARYKMNVFHWHLTDDQGWRAEIKRYPKLTTVGATRSDNVYWTGNGAKTGKPYGPYFYTQDEMREVVAYAKERHIEVLPEVDMPGHFVAAMAAYPEYSCNPSRAPQVWTGGGISSDVLNVANPQAVEFAKNILDELCDIFPYPYIHVGGDECPTTQWEHNDLCQQKYKELGLTSYRQLQAHFIKDLADFVATKNKHLVCWNEAITAGGADLQTQSTIMSWNPCQEGVAKAVKKLGLPAIVKGDGGYYICRKQSNDYGEPSGAGYGNDGVEGCYNYVPVQGMYTQEQMALVKGVQGTFWTEHVGTNEYLEYLALPRLICVAEAGWTPQVFKNWDNFRTRLANQTQWLDDHGYVYARHWMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and Structural Insights into the Specificity and Biological Functions of Bacterial Sulfoglycosidases
doi rcsb
molecule tags Hydrolase
source organism Prevotella
molecule keywords Beta-N-acetylhexosaminidase
total genus 101
structure length 515
sequence length 548
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.52: beta-N-acetylhexosaminidase.
pdb deposition date 2022-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...