8BDPA

A gh20 family sulfoglycosidase bt4394 in complex with nag-thiazoline and sulfite
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
523
structure length
523
Chain Sequence
EIALTPQPAHLTVKDGRFEFGNQLKAKVTPYQGDSIRMVFESFKKELQEATGIKVSSTQKEAKARIILDLNPQLPAEAYKLNVSKKQVRIEASRPAGFYYALQTLKQLMPRNVMAGVATSDHSQWSLPSVEIEDAPRFEWRGFMLDEGRHFFGKDEIKRVIDMMAIYKMNRFHWHLTEDQGWRIEIKKYPKLTETGAWRNSKVLAYGDVKPDGERYGGFYTQKDIKEIVAYAKKKFIEIIPEIDIPGHSQAAVAAYPEFLACDPRDKHEVWLQQGISTDVINVANPKAMQFAKEVIDELTELFPFNYIHLGGDECPTRKWQKNDECKKLLSEIGSSNFRDLQIYFYKQLKDYIATKPADQQRQLIFWNEVLHGNTSILGNDITIMAWIGANAAAKQAAKQGMNTILSPQIPYYINRKQSKLPTEPMSQGHGTETVEAVYNYQPLKDVDAALQPYYKGVQANFWTEWVTEPSVLEYLMLPRLAAVAEAGWTPQEKRNYEDFKERIRKDAELYDLKGWNYGKHIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic and Structural Insights into the Specificity and Biological Functions of Bacterial Sulfoglycosidases
doi rcsb
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron vpi-5482
molecule keywords Beta-N-acetylhexosaminidase
total genus 193
structure length 523
sequence length 523
ec nomenclature ec 3.2.1.52: beta-N-acetylhexosaminidase.
pdb deposition date 2022-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...