8BGBAAA

Structure of the citrate-bound extracytoplasmic pas domain of histidine kinase cita from geobacillus thermodenitrificans
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
STLKEQIGMRALNVAETVASTSLVREAFRDSNPSVRLQPFAERIRQKTGAEYVVIGNRQGIRYAHPLTERIGKSMIGGDNKEVLKGKSIISEAVGSLGPAIRGKAPIFDENGSVIGIVSVGFLLEDIQRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the citrate-bound extracytoplasmic PAS domain of histidine kinase CitA from Geobacillus thermodenitrificans
rcsb
molecule keywords Histidine kinase
molecule tags Signaling protein
source organism Geobacillus thermodenitrificans
total genus 41
structure length 130
sequence length 130
chains with identical sequence BBB, CCC, DDD, EEE, FFF, GGG, HHH
ec nomenclature ec 2.7.13.3: histidine kinase.
pdb deposition date 2022-10-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...