8BOQA

A. vinelandii fe-nitrogenase fefe protein
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
515
structure length
515
Chain Sequence
PHHEFECSKVIPERKKHAVIKGKGETLADALPQGYLNTIPGSISERGCAYCGAKHVIGTPMKDVIHISHGPVGCTYDTWQTKRYISDNDNFQLKYTYATDVKEKHIVFGAEKLLKQNIIEAFKAFPQIKRMTIYQTCATALIGDDINAIAEEVMEEMPEVDIFVCNSPGFAGPSQSGGHHKINIAWINQKVGTVEPEITGDHVINYVGEYNIQGDQEVMVDYFKRMGIQVLSTFTGNGSYDGLRAMHRAHLNVLECARSAEYICNELRVRYGIPRLDIDGFGFKPLADSLRKIGMFFGIEDRAKAIIDEEVARWKPELDWYKERLMGKKVCLWPGGSKLWHWAHVIEEEMGLKVVSVYTKFGHQGDMEKGIARCGEGTLAIDDPNELEGLEALEMLKPDIILTGKRPGEVAKKVRVPYLNAHAYHNGPYKGFEGWVRFARDIYNAIYSPIHQLSGIDITKDNAPEWGNGFRTRQMLSDGNLSDAVRNSETLRQYTGGYDSVSKLREREYPAFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Iron-only Fe-nitrogenase underscores common catalytic principles in biological nitrogen fixation
doi rcsb
molecule tags Oxidoreductase
molecule keywords Nitrogenase protein alpha chain
total genus 202
structure length 515
sequence length 515
chains with identical sequence D
ec nomenclature ec 1.18.6.1: nitrogenase.
pdb deposition date 2022-11-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...