8BRZA

Room-temperature structure of pedobacter heparinus n-acetylglucosamine 2-epimerase at 52 mpa helium gas pressure in a sapphire capillary
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
394
structure length
386
Chain Sequence
EYTLEKLKDLQGFYQKQLLDDTVPFWFPRSIDREFGGYLLMRDQDGSLIDDDKAVWIQGRAAWLLSTLYNTVEQKQEWLDGAKSGIDFLNRHCFDTDGQMFFHVTRDGQPIRKRRYYFSETFAVIANAAYAKASGDEAAAKQARYLFGKCIEYSTNPGTRPAKGIGVPMIMMNTAQQLRETIGDPRCDEWIDKWINEIETYFVKDDIRCVMEQVAPDGSIIDHIDGRTLNPGHAIEGAWFILHEAKYRNNDPRLIKLGCKMLDYMWDRGWDKEHGGILYFRDVYNKPVQEYWQDMKFWWPHNEVIIATLLAYTITGEEKYAQWHKLVHEYAYQHFHDAANGEWFGYLHKDGTLAQTAKGNLFKGPFHLPRQEWYCMTLLNEYLQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N-acylglucosamine 2-epimerase
publication title High-pressure macromolecular crystallography to explore the conformational space of proteins
rcsb
source organism Pedobacter heparinus
total genus 156
structure length 386
sequence length 394
chains with identical sequence B
ec nomenclature ec 5.1.3.8: N-acylglucosamine 2-epimerase.
pdb deposition date 2022-11-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...