8BYUH

Crystal structure of hexabody-cd38 fab in complex with cd38
Total Genus 47

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKAFGGTFSSYAISWVRQAPGQGLEWMGRIIRFLGIANYAQKFQGRVTLIADKSTNTAYMELSSLRSEDTAVYYCAGEPGERDPDAVDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (3-6)S11 (115-119)EMPTYS3 (18-25)TII1 (13-16)TI1 (52-55)S9 (92-99)TVIII1 (31-34)3H2 (88-90)S4 (33-39)3H1 (62-64)S5 (46-52)TI2 (53-56)TI3 (73-76)S6 (57-60)TII3 (64-67)S7 (68-72)S10 (110-111)TIV3 (103-106)S14 (143-153)TI4 (135-138)S13 (139-140)3H4 (194-196)TII'1 (140-143)S19 (202-208)3H3 (163-165)S15 (159-162)TVIII3 (165-168)S18 (184-193)S16 (171-173)TII4 (168-171)S17 (177-178)TI6 (179-182)TIV4 (197-200)S20 (213-219)3H5 (209-211)S2 (10-12)TIV2 (83-86)TII2 (40-43)S8 (78-83)TI7 (196-199)TVIII2 (101-104)S12 (128-132)Updating...
connected with : NaN
molecule tags Antitumor protein
source organism Homo sapiens
publication title Preclinical anti-tumour activity of HexaBody-CD38, a next-generation CD38 antibody with superior complement-dependent cytotoxic activity.
pubmed doi rcsb
molecule keywords Fab Heavy Chain
total genus 47
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2022-12-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.