8BZKA

Crystal structure of paradendryphiella salina pl7c alginate lyase with sulphate bound in the active site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
228
structure length
228
Chain Sequence
FLTAVSSIDTFLPVLNEAKLQWPTSALAASSEELLGGYVGSQFYLQDGKYMQFQIAGSSNRCELRQMIPDGGSEIGWAVDDGTTHTATSSIVVPEQVDGVEEVTIMQIHSGEAPQLRISWIRSKSLDGVAYEDFIMSTVRIGTGDSSDNFVKTHLADRTAGAMSFQIDVKDSKLTITVNGNVVVNGQDLSFWDGTDSCYFKAGAYNNNPTSESATARIKFAALAWVDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Alginate lyase
publication title Crystal structure of Paradendryphiella salina PL7C alginate lyase with sulphate bound in the active site
rcsb
source organism Paradendryphiella salina
total genus 57
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2022-12-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...