8C2SZ

Cryo-em structure ndufs4 knockout complex i from mus musculus heart (class 1).
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
141
Chain Sequence
SKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure NDUFS4 knockout complex I from Mus musculus heart (Class 1).
doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-ubiquinone oxidoreductase chain 3
total genus 37
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2022-12-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...