8C3NA

Stapled peptide sp30 in complex with humanised rada mutant humrada22
Total Genus 87

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
227
structure length
214
Chain Sequence
GRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERLREIAQNRGLDPDEVLDNVAYARAFNSNHQMQLLYQASAMMVESLTDRPYKLLIVDSLTSHFRSEYIGRGALAERQQKLARFLRMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (172-175)TII1 (129-132)S2 (128-129)S4 (167-172)TII2 (139-142)3H1 (159-161)AH2 (144-155)AH4 (193-199)AH3 (179-188)S5 (200-204)S3 (132-137)AH1 (118-124)TI'1 (124-127)AH5 (208-226)S1 (112-113)Updating...
connected with : NaN
molecule tags Recombination
source organism Pyrococcus furiosus
publication title A Recombinant Approach For Stapled Peptide Discovery Yields Inhibitors of the RAD51 Recombinase
doi rcsb
molecule keywords DNA repair and recombination protein RadA
total genus 87
structure length 214
sequence length 227
ec nomenclature
pdb deposition date 2022-12-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.