8C4LA

Ferric-siderophore reduction in shewanella biscestrii: structural and functional characterization of sbisip reveals unforeseen specificity
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
243
structure length
243
Chain Sequence
PAPRELTVIGKTQVTPHMLRITLGGAGFAGFPADQESAYIKLLFPQQGDERPLMRTYTIRQQRMNEIDVDFVLHDTDGPASRWAKSTEIGDTIQIGGPGLKKLINLNAEWFLLAGDMTALPAISVNLTQLPNNAVGYAVIEVLSEADIQPLVHPRNVQLHWVINPEADPEGKPLAERIAQLPKLEGQGAVWLACEFSSMRALRKLLKQTYDLPKSHFYTSSYWKIGCNEGEHKLVKQQDEQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Vibriobactin utilization protein ViuB
publication title Ferric-siderophore reduction in Shewanella bicestrii: Structural and functional characterization of SbSIP reveals an overlooked specificity of siderophore interacting proteins
rcsb
source organism Shewanella bicestrii
total genus 64
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-01-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...