8C7GB

Drosophila melanogaster rab7 gef complex mon1-ccz1-bulli
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
479
structure length
402
Chain Sequence
QRVEITLRSFYIFNSTFGQVEGEEHKKVLFYHPNDIELNTKIKDVGLSEAIIRFTGTFTSEDDCQALHTQKTTQLFYQPEPGYWLVLVLNVPKEVVADYRGAEISDRIYRAILRQCYQMFRFQNGCFSSCGSEEPNPDKRRELLCQKLLQFYDQHLTNLRDPAQCDIIDMLHSIQYLPLDKTLFLRAQNFGTLCETFPDIKESIMLYQEQVLCGGKLSPEDLHCVHSYVVQHVLKVGGFVRDHPMKVYVTLDKEAKPYYLLIYRALHITLCLFLNADQVAPKQDLYDDLHAYMAPQLTSLARDISSELTKEAPKYLFINEQSLQHHTNFLPRNVLSIIADLANAPAEEVQVKTTNDYWIVKRRCNYRQYYVILCNSKATLLDVTQEARRIFEQELTDDVFFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Mic1 domain-containing protein
publication title Structure of the metazoan Rab7 GEF complex Mon1-Ccz1-Bulli.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 81
structure length 402
sequence length 479
ec nomenclature
pdb deposition date 2023-01-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...