8C7IA

Crystal structure of the ps2 assembly factor psb32 from the cyanobactium thermosyncechococcus vestitus (formerly elongatus)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
410
structure length
404
Chain Sequence
PQFEKASMSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKYRIRENLYFQGATSAIDIPFPGTATGVIDEGNVLSAVTQGSVGRSLQDLSEATGINVHVVTLHRLDYGETPQSFVDDLFSQWFPDPESQANQVIIALDTVTNGTAIHYGDAVAERLNPETAESIVQETMRVPLREGNYNQAVLDTVDRLGKVLKGEPDPGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Green fluorescent protein,Tll0404 protein
publication title Cryo-EM analysis of a novel photosystem II assembly intermediate that binds Psb32
rcsb
source organism Aequorea victoria
total genus 129
structure length 404
sequence length 410
ec nomenclature
pdb deposition date 2023-01-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...