8CBVA

Hiv-1 integrase catalytic core domain and c-terminal domain in complex with allosteric integrase inhibitor mut916
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
52
structure length
50
Chain Sequence
NFRVYYRDDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRDYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biological and Structural Analyses of New Potent Allosteric Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
molecule keywords Integrase
molecule tags Viral protein
source organism Human immunodeficiency virus 1
total genus 7
structure length 50
sequence length 52
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2023-01-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...