8CH6Z

Structure of a late-stage activated spliceosome (baqr) arrested with a dominant-negative aquarius mutant (state b complex).
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
95
Chain Sequence
LRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERECFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of catalytic activation in human splicing.
pubmed doi rcsb
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein E
total genus 11
structure length 95
sequence length 121
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2023-02-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...