8CHEA

Tlt-1 binding fab of the bispecific antibody hmb-001 in complex with the tlt-1 stalk peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMTWVRQAPGKGLVWVGEINPDSSTINYAPSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCASGVFTSWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title HMB-001: A Novel Bispecific Antibody Accumulating and Targeting Endogenous FVIIa to Activated Platelets for Subcutaneous Prophylaxis in Multiple Bleeding Disorders Including Glanzmann Thrombasthenia.
rcsb
molecule keywords Fab heavy chain
molecule tags Blood clotting
source organism Homo sapiens
total genus 47
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2023-02-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...