8CMYB

Structure of the cyanobium sp. pcc 7001 determined with c1 symmetry
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
TVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLIEHVHPSRSMATYWSYWKLPFFGEKDLGVIVSELEACHRAYPDHHVRLVGYDAYTQSQGACFVVFEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single-particle cryo-EM analysis of the shell architecture and internal organization of an intact alpha-carboxysome.
pubmed doi rcsb
molecule keywords Ribulose bisphosphate carboxylase large chain
molecule tags Photosynthesis
total genus 19
structure length 108
sequence length 108
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.1.1.39: ribulose-bisphosphate carboxylase.
pdb deposition date 2023-02-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...