8CTHA

Cryo-em structure of human mettl1-wdr4-trna(phe) complex
Total Genus 45

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
237
structure length
216
Chain Sequence
HSNPMADHTLRYPVKPEEMDWSELYPEFFAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS2 (102-107)TVIII1 (38-41)3H1 (41-43)TI2 (45-48)TIV1 (48-51)TI5 (50-53)TI3 (46-49)TII'1 (85-88)S1 (78-83)3H2 (95-97)AH1 (89-94)TI7 (98-101)TI9 (140-143)AH3 (144-148)AH2 (110-125)S3 (134-138)TI8 (126-129)AH5 (201-213)S4 (154-160)TII1 (150-153)O1 (163-165)TIV4 (159-162)3H3 (168-170)TI11 (170-173)TI12 (171-174)AH4 (178-187)S5 (188-198)TI1 (28-31)TIV3 (131-134)Updating...
connected with : NaN
molecule tags Transferase/rna
source organism Homo sapiens
publication title Structural basis of regulated m 7 G tRNA modification by METTL1-WDR4.
pubmed doi rcsb
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
total genus 45
structure length 216
sequence length 237
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2022-05-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.