8CU5A

Crystal structure of putative cyclophilin b from brugia malayi
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
183
structure length
183
Chain Sequence
KEMATVTKKVYFDIAIGDKKIGRIEIGLFGNDVPKTVENFRALATGEKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTVQTTWLDGRHVVFGKVLSGMDVVRKIEQTSTHPGDRPKQSVEIVDCGELSLDAPFDTPKEAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Cyclophilin B from Brugia malayi
rcsb
molecule tags Isomerase
source organism Brugia malayi
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 54
structure length 183
sequence length 183
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2022-05-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...