8D3PI

Type i-c cas4-cas1-cas2 complex bound to half-site integration intermediate (hsi)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
ASNEEDRYLMLSGLQHFQFCKRQWALIHIEQQWEENVRTIEGQHLHKKADQPFMKEKRGSKLTVRAMPIQSKNLQISGICDVVEFVQDSEGIELSGVSGSYKAFPVEYKRGKPKKGDEDIVQLVAQAMCLEEMLVCRIDKGYLFYNEIKHRVEVPITDALRDKVVQMAKEMHHYYENRHTPKVKTGPFCNNCSLQSICLPKLMNKRSVKRYIEGRLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PAM binding ensures orientational integration during Cas4-Cas1-Cas2-mediated CRISPR adaptation.
pubmed doi rcsb
molecule keywords CRISPR-associated endonuclease Cas1
molecule tags Hydrolase/dna
source organism Alkalihalobacillus halodurans c-125
total genus 39
structure length 218
sequence length 218
ec nomenclature ec 3.1.12.1: 5' to 3' exodeoxyribonuclease (nucleoside 3'-phosphate-forming).
pdb deposition date 2022-06-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...