8D4RD

Crystal structure of mosaic hiv-1 envelope (mosm3.2) in complex with antibodies pgt124 and 35o22 at 3.8 angstrom
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
EGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLGCLVKDYFPEPVTVHTFPAVLQSSGLYSLSSCNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The domain-swaped dimer of the HIV-1 CD4bs targeting antibody 21N13
rcsb
molecule keywords Envelope glycoprotein gp120
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2022-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...