8D9LA

Cryoem structure of human mettl1-wdr4 in complex with lys-trna and sam
Total Genus 49

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
221
Chain Sequence
HSNPMADHTLRYPVKPEEMDWSELYPEFFAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPAPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (28-31)AH2 (110-125)TVIII1 (38-41)TIV1 (40-43)TI2 (41-44)TIV2 (45-48)TI3 (46-49)TI4 (47-50)TVIII2 (48-51)S5 (188-198)TI6 (51-54)AH1 (89-95)S1 (80-83)TII'1 (85-88)TIV3 (82-85)TI7 (95-98)TIV4 (96-99)TI8 (98-101)TI9 (126-129)S3 (134-138)TI10 (140-143)TIV6 (141-144)TI11 (214-217)AH3 (178-187)TII1 (150-153)AH4 (201-213)S4 (154-160)3H2 (171-173)S6 (217-220)S2 (103-107)TIV8 (159-162)TII2 (167-170)3H1 (145-147)TIV5 (131-134)Updating...
connected with : NaN
molecule tags Transferase/rna
source organism Homo sapiens
publication title Structures and mechanisms of tRNA methylation by METTL1-WDR4.
pubmed doi rcsb
molecule keywords tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
total genus 49
structure length 221
sequence length 240
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2022-06-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.