8DAKA

Crystal structure of the gdp-d-glycero-4-keto-d-lyxo-heptose-3-epimerase from campylobacter jejuni, serotype hs:3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
178
Chain Sequence
HMAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTSEAVDKLLPNGLKFIHDKFIHSKHNVIRGIHGDVKTYKLATCVYGEVHQVVVDCRKDSPTYLKHERFIINQDNQKIILVPAGFGNAHYVSSETAVYYYKCAYLGEYMDAPDQFTYAWNDERIGIDWPTNNPILSERDILAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GDP-D-glycero-4-keto-d-lyxo-heptose-3-epimerase
publication title C3- and C3/C5-Epimerases Required for the Biosynthesis of the Capsular Polysaccharides from Campylobacter jejuni .
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 46
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2022-06-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...