8DAMC

Nbf3:nbe8:cav beta subunit 1b complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GQVQLQESGGGSVQAGGSLRLSCAASGRTFSKNAMGWFRQAPGKEREFVVAISWSGRNTYYADSVKGRFTISRDNAKNTVDLQMNSLKPEDSAVYYCAVGGDWRVYDISFYYTAHQYEYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective posttranslational inhibition of Ca V beta 1 -associated voltage-dependent calcium channels with a functionalized nanobody.
pubmed doi rcsb
molecule keywords Voltage-dependent L-type calcium channel subunit beta-1
molecule tags Transport protein/immune system
source organism Mus musculus
total genus 36
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2022-06-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...