8DOWC

Cryo-em structure of hiv-1 env(ch848 10.17 ds.sosip_dt) in complex with dh1030.1 fab
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
225
Chain Sequence
EVQLAESGGGLTKPGGSLRLSCAASGFTFSDFYMDWVRQTPGKGLEWVSRINNDGRNKWYADSVRGRFTVSRENAKNTLYLQMDSLRAEDTAVYYCARDRPVYRYWSGGYHLDPWGQGVVVTVSSASTKGPSVFPLAPSSRSTSESTAALGCLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYVCNVNHKPSNTKVDKRVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shared recognition mechanism for HIV-1 envelope-reactive V3 glycan broadly neutralizing B cell lineage maturation in humans and macaques
rcsb
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
molecule keywords Envelope glycoprotein gp120
total genus 51
structure length 225
sequence length 225
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2022-07-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...