8DP0B

Structure of p110 gamma bound to the ras inhibitory nanobody nb7
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGSIFSINAMGWYRQAPGKQRELVAHITSGGSTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNEAGDPFLGSTWNGPPAFGSWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation or inhibition of PI3K gamma mediated through conformational changes in the p110 gamma helical domain.
pubmed doi rcsb
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
molecule tags Transferase/immune system
source organism Homo sapiens
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2022-07-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...