8DSGA

P411-pfa carbene transferase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
454
structure length
450
Chain Sequence
IKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKTLSQGLKFLRDFLGDGLATSWTHEKNWKKAHNILLPSFSQQAMKGYHASMVDIAVQLVQKWERLNADEHIEVSEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFIISMVRALDEVMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKATDDLLTQMLNGKDPETGEPLDDGNIRYQIITFLYAGVEGTSGLLSFALYFLVKNPHVLQKVAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPVVPVFSLYAKEDTVLGGEYPLEKGDEVMVLIPQLHRDKTVWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRASPGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKELQTLKPKGFVVKAKSKKIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemodivergent C(sp3)-H and C(sp2)-H cyanomethylation using engineered carbene transferases
doi rcsb
molecule keywords Cytochrome P450-BM3 variant P411-PFA
molecule tags Oxidoreductase
source organism Priestia megaterium
total genus 175
structure length 450
sequence length 454
chains with identical sequence B, C, D
ec nomenclature ec 1.14.14.1: unspecific monooxygenase.
pdb deposition date 2022-07-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...