8DVDA

Cryo-em structure of sivmac239 sos-2p env trimer in complex with human bnab pgt145
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
134
Chain Sequence
GVFVLGFLGFLATAGSAMGAASLTLTAQSRTLLAGIVQQQQQLLDGTKNLQTRVTAIEKYLKDQAQLNAWGCAFRQVCCTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Cryo-EM structures of prefusion SIV envelope trimer.
pubmed doi rcsb
source organism Simian immunodeficiency virus
total genus 35
structure length 134
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2022-07-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...