8DX0A

Vansc ca domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
139
Chain Sequence
TETTDLSLMLEQLTFEFLPLLEEKNLNWQLNLQKNVLATVDTEKIARVFDNLIRNAINYSYPDSPLLLELVESDSIHIRLTNRGKTIPEEMIGRLFEPFYRMDGLGLPIAKEILLASGGDISAESKDETIIFNVRLPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of VanS from vancomycin-resistant enterococci: A sensor kinase with weak ATP binding.
pubmed doi rcsb
molecule tags Signaling protein
source organism Enterococcus
molecule keywords Histidine kinase
total genus 44
structure length 139
sequence length 149
chains with identical sequence B
ec nomenclature ec 2.7.13.3: histidine kinase.
pdb deposition date 2022-08-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...